SCOP 1.73: Domain d1ydfa1: 1ydf A:4-256

Lineage for d1ydfa1 (1ydf A:4-256)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (23 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.14: NagD-like [102317] (6 proteins)
   duplication: consists of two segment-swapped domains of this fold; this results in the insertion of a circularly permuted domain after strand 3, analogously to the Cof family

6. Protein Putative hydrolase SP1407 [142171] (1 species)

7. Species Streptococcus pneumoniae [TaxId:1313] [142172] (1 PDB entry)

8. Domain d1ydfa1: 1ydf A:4-256 [122996]
   complexed with mg

Details for d1ydfa1

PDB Entry: 1ydf, 2.6 Å

PDB Description: crystal structure of a had-like phosphatase from streptococcus pneumoniae

PDB Compounds: (A:) Hydrolase, haloacid dehalogenase-like family

SCOP Domain Sequences for d1ydfa1:

Sequence; same for both SEQRES and ATOM records:

>d1ydfa1 c.108.1.14 (A:4-256) Putative hydrolase SP1407 {Streptococcus pneumoniae [TaxId: 1313]}
ykgylidldgtiykgkdripagetfvhelqkrdipylfvtnnttrtpesvkemlaqnfni
dtplstvytatlatidymndlglektvyvvgeaglkeaikaagyvedkekpayvvvgldw
qvdyekfatatlaiqkgahfigtnpdlniptergllpgagslitllevatrvkpvyigkp
naiimdkavehlglereelimvgdnyltdiragidngiptllvttgftkaeevaglpiap
thvvsslaewdfd

Timeline for d1ydfa1:

• d1ydfa1 is new in SCOP 1.73
  
• d1ydfa1 appears in SCOP 1.75
  
• d1ydfa1 appears in the current release, SCOPe 2.08