Lineage for d1ydfa1 (1ydf A:4-256)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920095Family c.108.1.14: NagD-like [102317] (7 proteins)
    duplication: consists of two segment-swapped domains of this fold; this results in the insertion of a circularly permuted domain after strand 3, analogously to the Cof family
  6. 2920109Protein Putative hydrolase SP1407 [142171] (1 species)
  7. 2920110Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [142172] (1 PDB entry)
    Uniprot Q97Q24 3-255
  8. 2920111Domain d1ydfa1: 1ydf A:4-256 [122996]
    Other proteins in same PDB: d1ydfa2
    complexed with mg

Details for d1ydfa1

PDB Entry: 1ydf (more details), 2.6 Å

PDB Description: crystal structure of a had-like phosphatase from streptococcus pneumoniae
PDB Compounds: (A:) Hydrolase, haloacid dehalogenase-like family

SCOPe Domain Sequences for d1ydfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ydfa1 c.108.1.14 (A:4-256) Putative hydrolase SP1407 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
ykgylidldgtiykgkdripagetfvhelqkrdipylfvtnnttrtpesvkemlaqnfni
dtplstvytatlatidymndlglektvyvvgeaglkeaikaagyvedkekpayvvvgldw
qvdyekfatatlaiqkgahfigtnpdlniptergllpgagslitllevatrvkpvyigkp
naiimdkavehlglereelimvgdnyltdiragidngiptllvttgftkaeevaglpiap
thvvsslaewdfd

SCOPe Domain Coordinates for d1ydfa1:

Click to download the PDB-style file with coordinates for d1ydfa1.
(The format of our PDB-style files is described here.)

Timeline for d1ydfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ydfa2