Lineage for d1yden_ (1yde N:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
    has additional subdomain(s) that are not in the common domain
  6. 2842913Protein automated matches [190085] (59 species)
    not a true protein
  7. 2843171Species Human (Homo sapiens) [TaxId:9606] [186828] (21 PDB entries)
  8. 2843193Domain d1yden_: 1yde N: [122993]
    Other proteins in same PDB: d1ydea1
    automated match to d1ydea1

Details for d1yden_

PDB Entry: 1yde (more details), 2.4 Å

PDB Description: Crystal Structure of Human Retinal Short-Chain Dehydrogenase/Reductase 3
PDB Compounds: (N:) Retinal dehydrogenase/reductase 3

SCOPe Domain Sequences for d1yden_:

Sequence, based on SEQRES records: (download)

>d1yden_ c.2.1.2 (N:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdvtqeddv
ktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltklalpyl
rksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncispgniwt
plweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctgiellvtgga
elgygcka

Sequence, based on observed residues (ATOM records): (download)

>d1yden_ c.2.1.2 (N:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdvtqeddv
ktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltklalpyl
rksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncispgniwt
plweprasiregmlaqplgrmgqpaevgaaavflaseanfctgiellvtggaelgygcka

SCOPe Domain Coordinates for d1yden_:

Click to download the PDB-style file with coordinates for d1yden_.
(The format of our PDB-style files is described here.)

Timeline for d1yden_: