![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
![]() | Protein automated matches [190085] (59 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186828] (21 PDB entries) |
![]() | Domain d1ydek_: 1yde K: [122990] Other proteins in same PDB: d1ydea1 automated match to d1ydea1 |
PDB Entry: 1yde (more details), 2.4 Å
SCOPe Domain Sequences for d1ydek_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ydek_ c.2.1.2 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdv tqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltk lalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncis pgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctgiel lvtggaelgy
Timeline for d1ydek_: