Lineage for d1ydek_ (1yde K:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. Protein automated matches [190085] (57 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [186828] (21 PDB entries)
  8. Domain d1ydek_: 1yde K: [122990]
    Other proteins in same PDB: d1ydea1
    automated match to d1ydea1

Details for d1ydek_

PDB Entry: 1yde (more details), 2.4 Å

PDB Description: Crystal Structure of Human Retinal Short-Chain Dehydrogenase/Reductase 3
PDB Compounds: (K:) Retinal dehydrogenase/reductase 3

SCOPe Domain Sequences for d1ydek_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ydek_ c.2.1.2 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdv
tqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltk
lalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncis
pgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctgiel
lvtggaelgy

SCOPe Domain Coordinates for d1ydek_ are not available.

Timeline for d1ydek_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ydea1, d1ydeb_, d1ydec_, d1yded_, d1ydee_, d1ydef_, d1ydeg_, d1ydeh_, d1ydei_, d1ydej_, d1ydel_, d1ydem_, d1yden_, d1ydeo_, d1ydep_