Lineage for d1ydej_ (1yde J:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1826923Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1828143Protein automated matches [190085] (47 species)
    not a true protein
  7. 1828311Species Human (Homo sapiens) [TaxId:9606] [186828] (9 PDB entries)
  8. 1828329Domain d1ydej_: 1yde J: [122989]
    Other proteins in same PDB: d1ydea1
    automated match to d1ydea1

Details for d1ydej_

PDB Entry: 1yde (more details), 2.4 Å

PDB Description: Crystal Structure of Human Retinal Short-Chain Dehydrogenase/Reductase 3
PDB Compounds: (J:) Retinal dehydrogenase/reductase 3

SCOPe Domain Sequences for d1ydej_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ydej_ c.2.1.2 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdv
tqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltk
lalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncis
pgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctgiel
lvtggaelgygckas

SCOPe Domain Coordinates for d1ydej_:

Click to download the PDB-style file with coordinates for d1ydej_.
(The format of our PDB-style files is described here.)

Timeline for d1ydej_: