Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
Protein Retinal dehydrogenase/reductase 3 [141907] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141908] (1 PDB entry) |
Domain d1ydeh1: 1yde H:5-253 [122987] automatically matched to 1YDE A:4-253 |
PDB Entry: 1yde (more details), 2.4 Å
SCOP Domain Sequences for d1ydeh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ydeh1 c.2.1.2 (H:5-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} tryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdvt qeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltkl alpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncisp gniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctgiell vtggaelgy
Timeline for d1ydeh1: