Lineage for d1ydec1 (1yde C:4-253)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 819736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 820607Protein Retinal dehydrogenase/reductase 3 [141907] (1 species)
  7. 820608Species Human (Homo sapiens) [TaxId:9606] [141908] (1 PDB entry)
    Uniprot Q9BPX1 4-253
  8. 820611Domain d1ydec1: 1yde C:4-253 [122982]
    automatically matched to 1YDE A:4-253

Details for d1ydec1

PDB Entry: 1yde (more details), 2.4 Å

PDB Description: Crystal Structure of Human Retinal Short-Chain Dehydrogenase/Reductase 3
PDB Compounds: (C:) Retinal dehydrogenase/reductase 3

SCOP Domain Sequences for d1ydec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ydec1 c.2.1.2 (C:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]}
gtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdv
tqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltk
lalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncis
pgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctgiel
lvtggaelgy

SCOP Domain Coordinates for d1ydec1:

Click to download the PDB-style file with coordinates for d1ydec1.
(The format of our PDB-style files is described here.)

Timeline for d1ydec1: