![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
![]() | Protein Retinal dehydrogenase/reductase 3 [141907] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141908] (3 PDB entries) Uniprot Q9BPX1 4-253 |
![]() | Domain d1ydea1: 1yde A:4-253 [122980] Other proteins in same PDB: d1ydeb_, d1ydec_, d1yded_, d1ydee_, d1ydef_, d1ydeg_, d1ydeh_, d1ydei_, d1ydej_, d1ydek_, d1ydel_, d1ydem_, d1yden_, d1ydeo_, d1ydep_ |
PDB Entry: 1yde (more details), 2.4 Å
SCOPe Domain Sequences for d1ydea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} gtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdv tqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltk lalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncis pgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctgiel lvtggaelgy
Timeline for d1ydea1: