Lineage for d1ydea1 (1yde A:4-253)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
    has additional subdomain(s) that are not in the common domain
  6. 2842737Protein Retinal dehydrogenase/reductase 3 [141907] (1 species)
  7. 2842738Species Human (Homo sapiens) [TaxId:9606] [141908] (15 PDB entries)
    Uniprot Q9BPX1 4-253
  8. 2842747Domain d1ydea1: 1yde A:4-253 [122980]
    Other proteins in same PDB: d1ydeb_, d1ydec_, d1yded_, d1ydee_, d1ydef_, d1ydeg_, d1ydeh_, d1ydei_, d1ydej_, d1ydek_, d1ydel_, d1ydem_, d1yden_, d1ydeo_, d1ydep_

Details for d1ydea1

PDB Entry: 1yde (more details), 2.4 Å

PDB Description: Crystal Structure of Human Retinal Short-Chain Dehydrogenase/Reductase 3
PDB Compounds: (A:) Retinal dehydrogenase/reductase 3

SCOPe Domain Sequences for d1ydea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]}
gtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdv
tqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltk
lalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncis
pgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctgiel
lvtggaelgy

SCOPe Domain Coordinates for d1ydea1:

Click to download the PDB-style file with coordinates for d1ydea1.
(The format of our PDB-style files is described here.)

Timeline for d1ydea1: