Lineage for d1yd9d_ (1yd9 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2881110Fold c.50: Macro domain-like [52948] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest
  4. 2881111Superfamily c.50.1: Macro domain-like [52949] (4 families) (S)
  5. 2881815Family c.50.1.0: automated matches [191326] (1 protein)
    not a true family
  6. 2881816Protein automated matches [190146] (12 species)
    not a true protein
  7. 2881850Species Norway rat (Rattus norvegicus) [TaxId:10116] [186871] (1 PDB entry)
  8. 2881853Domain d1yd9d_: 1yd9 D: [122979]
    Other proteins in same PDB: d1yd9a1, d1yd9c3
    automated match to d1spva_
    complexed with au

Details for d1yd9d_

PDB Entry: 1yd9 (more details), 1.6 Å

PDB Description: 1.6A Crystal Structure of the Non-Histone Domain of the Histone Variant MacroH2A1.1.
PDB Compounds: (D:) Core histone macro-H2A.1

SCOPe Domain Sequences for d1yd9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yd9d_ c.50.1.0 (D:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gftvlstkslflgqklqvvqadiasidsdavvhptntdfyiggevgstlekkggkefvea
vlelrkkngplevagaavsaghglpakfvihcnspvwgsdkceellektvknclaladdr
klksiafpsigsgrngfpkqtaaqlilkaissyfvstmsssiktvyfvlfdsesigiyvq
emakldan

SCOPe Domain Coordinates for d1yd9d_:

Click to download the PDB-style file with coordinates for d1yd9d_.
(The format of our PDB-style files is described here.)

Timeline for d1yd9d_: