Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.50: Macro domain-like [52948] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest |
Superfamily c.50.1: Macro domain-like [52949] (4 families) |
Family c.50.1.0: automated matches [191326] (1 protein) not a true family |
Protein automated matches [190146] (12 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [186871] (1 PDB entry) |
Domain d1yd9d_: 1yd9 D: [122979] Other proteins in same PDB: d1yd9a1, d1yd9c3 automated match to d1spva_ complexed with au |
PDB Entry: 1yd9 (more details), 1.6 Å
SCOPe Domain Sequences for d1yd9d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yd9d_ c.50.1.0 (D:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} gftvlstkslflgqklqvvqadiasidsdavvhptntdfyiggevgstlekkggkefvea vlelrkkngplevagaavsaghglpakfvihcnspvwgsdkceellektvknclaladdr klksiafpsigsgrngfpkqtaaqlilkaissyfvstmsssiktvyfvlfdsesigiyvq emakldan
Timeline for d1yd9d_:
View in 3D Domains from other chains: (mouse over for more information) d1yd9a1, d1yd9b_, d1yd9c2, d1yd9c3 |