![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
![]() | Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
![]() | Family b.38.1.4: PF1955-like [141294] (2 proteins) homohexadecameric assembly: two stacked octameric rings automatically mapped to Pfam PF11451 |
![]() | Protein automated matches [190426] (1 species) not a true protein |
![]() | Species Pyrococcus furiosus [TaxId:2261] [187316] (1 PDB entry) |
![]() | Domain d1ycyd_: 1ycy D: [122973] Other proteins in same PDB: d1ycya1 automated match to d1ycya1 |
PDB Entry: 1ycy (more details), 2.8 Å
SCOPe Domain Sequences for d1ycyd_:
Sequence, based on SEQRES records: (download)
>d1ycyd_ b.38.1.4 (D:) automated matches {Pyrococcus furiosus [TaxId: 2261]} sllekvlkewkghkvavsvggdhsftgtledfdeevillkdvvdvignrgkqmligledi nwimll
>d1ycyd_ b.38.1.4 (D:) automated matches {Pyrococcus furiosus [TaxId: 2261]} sllekvlkewkghkvavsvgftgtledfdeevillkdvvdvignrgkqmligledinwim ll
Timeline for d1ycyd_: