SCOP 1.75: Domain d1ycyc1: 1ycy C:5-70

Lineage for d1ycyc1 (1ycy C:5-70)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (6 families)

5. Family b.38.1.4: PF1955-like [141294] (1 protein)
   homohexadecameric assembly: two stacked octameric rings

6. Protein Hypothetical protein PF1955 [141295] (1 species)

7. Species Pyrococcus furiosus [TaxId:2261] [141296] (1 PDB entry)
   Uniprot Q8TZN2 5-70

8. Domain d1ycyc1: 1ycy C:5-70 [122972]
   automatically matched to 1YCY A:5-70

Details for d1ycyc1

PDB Entry: 1ycy, 2.8 Å

PDB Description: conserved hypothetical protein pfu-1806301-001 from pyrococcus furiosus

PDB Compounds: (C:) conserved hypothetical protein

SCOP Domain Sequences for d1ycyc1:

Sequence, based on SEQRES records:

>d1ycyc1 b.38.1.4 (C:5-70) Hypothetical protein PF1955 {Pyrococcus furiosus [TaxId: 2261]}
sllekvlkewkghkvavsvggdhsftgtledfdeevillkdvvdvignrgkqmligledi
nwimll

Sequence, based on observed residues (ATOM records):

>d1ycyc1 b.38.1.4 (C:5-70) Hypothetical protein PF1955 {Pyrococcus furiosus [TaxId: 2261]}
sllekvlkewkghkvavsvgftgtledfdeevillkdvvdvignrgkqmligledinwim
ll

Timeline for d1ycyc1:

• d1ycyc1 first appeared in SCOP 1.73
  
• d1ycyc1 is called d1ycyc_ in SCOPe 2.01
  
• d1ycyc1 appears in the current release, SCOPe 2.08, called d1ycyc_