SCOPe 2.08: Domain d1ycyc_: 1ycy C:

Lineage for d1ycyc_ (1ycy C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.4: PF1955-like [141294] (2 proteins)
   homohexadecameric assembly: two stacked octameric rings
   automatically mapped to Pfam PF11451

6. Protein automated matches [190426] (1 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:2261] [187316] (1 PDB entry)

8. Domain d1ycyc_: 1ycy C: [122972]
   Other proteins in same PDB: d1ycya1
   automated match to d1ycya1

Details for d1ycyc_

PDB Entry: 1ycy, 2.8 Å

PDB Description: conserved hypothetical protein pfu-1806301-001 from pyrococcus furiosus

PDB Compounds: (C:) conserved hypothetical protein

SCOPe Domain Sequences for d1ycyc_:

Sequence, based on SEQRES records:

>d1ycyc_ b.38.1.4 (C:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
sllekvlkewkghkvavsvggdhsftgtledfdeevillkdvvdvignrgkqmligledi
nwimll

Sequence, based on observed residues (ATOM records):

>d1ycyc_ b.38.1.4 (C:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
sllekvlkewkghkvavsvgftgtledfdeevillkdvvdvignrgkqmligledinwim
ll

Timeline for d1ycyc_:

• d1ycyc_ first appeared in SCOP 1.73, called d1ycyc1
  
• d1ycyc_ appears in SCOPe 2.07