Lineage for d1ycyb1 (1ycy B:5-70)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798178Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 798179Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (6 families) (S)
  5. 798487Family b.38.1.4: PF1955-like [141294] (1 protein)
    homohexadecameric assembly: two stacked octameric rings
  6. 798488Protein Hypothetical protein PF1955 [141295] (1 species)
  7. 798489Species Pyrococcus furiosus [TaxId:2261] [141296] (1 PDB entry)
    Uniprot Q8TZN2 5-70
  8. 798491Domain d1ycyb1: 1ycy B:5-70 [122971]
    automatically matched to 1YCY A:5-70

Details for d1ycyb1

PDB Entry: 1ycy (more details), 2.8 Å

PDB Description: conserved hypothetical protein pfu-1806301-001 from pyrococcus furiosus
PDB Compounds: (B:) conserved hypothetical protein

SCOP Domain Sequences for d1ycyb1:

Sequence, based on SEQRES records: (download)

>d1ycyb1 b.38.1.4 (B:5-70) Hypothetical protein PF1955 {Pyrococcus furiosus [TaxId: 2261]}
sllekvlkewkghkvavsvggdhsftgtledfdeevillkdvvdvignrgkqmligledi
nwimll

Sequence, based on observed residues (ATOM records): (download)

>d1ycyb1 b.38.1.4 (B:5-70) Hypothetical protein PF1955 {Pyrococcus furiosus [TaxId: 2261]}
sllekvlkewkghkvavsvgftgtledfdeevillkdvvdvignrgkqmligledinwim
ll

SCOP Domain Coordinates for d1ycyb1:

Click to download the PDB-style file with coordinates for d1ycyb1.
(The format of our PDB-style files is described here.)

Timeline for d1ycyb1: