Lineage for d1ycya1 (1ycy A:5-70)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1786638Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1786639Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1787158Family b.38.1.4: PF1955-like [141294] (2 proteins)
    homohexadecameric assembly: two stacked octameric rings
    automatically mapped to Pfam PF11451
  6. 1787159Protein Hypothetical protein PF1955 [141295] (1 species)
  7. 1787160Species Pyrococcus furiosus [TaxId:2261] [141296] (1 PDB entry)
    Uniprot Q8TZN2 5-70
  8. 1787161Domain d1ycya1: 1ycy A:5-70 [122970]
    Other proteins in same PDB: d1ycyb_, d1ycyc_, d1ycyd_

Details for d1ycya1

PDB Entry: 1ycy (more details), 2.8 Å

PDB Description: conserved hypothetical protein pfu-1806301-001 from pyrococcus furiosus
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1ycya1:

Sequence, based on SEQRES records: (download)

>d1ycya1 b.38.1.4 (A:5-70) Hypothetical protein PF1955 {Pyrococcus furiosus [TaxId: 2261]}
sllekvlkewkghkvavsvggdhsftgtledfdeevillkdvvdvignrgkqmligledi
nwimll

Sequence, based on observed residues (ATOM records): (download)

>d1ycya1 b.38.1.4 (A:5-70) Hypothetical protein PF1955 {Pyrococcus furiosus [TaxId: 2261]}
sllekvlkewkghkvavsvgftgtledfdeevillkdvvdvignrgkqmligledinwim
ll

SCOPe Domain Coordinates for d1ycya1:

Click to download the PDB-style file with coordinates for d1ycya1.
(The format of our PDB-style files is described here.)

Timeline for d1ycya1: