SCOP 1.73: Domain d1ycma1: 1ycm A:106-263

Lineage for d1ycma1 (1ycm A:106-263)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)

6. Protein Macrophage elastase (MMP-12) [69780] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69781] (15 PDB entries)

8. Domain d1ycma1: 1ycm A:106-263 [122969]
   automatically matched to d1os2a_
   complexed with ca, ngh, zn; mutant

Details for d1ycma1

PDB Entry: 1ycm

PDB Description: solution structure of matrix metalloproteinase 12 (mmp12) in the presence of n-isobutyl-n-[4-methoxyphenylsulfonyl]glycyl hydroxamic acid (nngh)

PDB Compounds: (A:) Macrophage metalloelastase

SCOP Domain Sequences for d1ycma1:

Sequence; same for both SEQRES and ATOM records:

>d1ycma1 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

Timeline for d1ycma1:

• d1ycma1 is new in SCOP 1.73
  
• d1ycma1 appears in SCOP 1.75
  
• d1ycma1 appears in the current release, SCOPe 2.08, called d1ycma2