Lineage for d1ycma2 (1ycm A:106-263)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964231Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2964411Protein Macrophage elastase (MMP-12) [69780] (1 species)
  7. 2964412Species Human (Homo sapiens) [TaxId:9606] [69781] (58 PDB entries)
    Uniprot P39900 106-263 ! Uniprot P39900 106-264
  8. 2964508Domain d1ycma2: 1ycm A:106-263 [122969]
    Other proteins in same PDB: d1ycma3
    automated match to d1os9a_
    complexed with ca, ngh, zn

Details for d1ycma2

PDB Entry: 1ycm (more details)

PDB Description: solution structure of matrix metalloproteinase 12 (mmp12) in the presence of n-isobutyl-n-[4-methoxyphenylsulfonyl]glycyl hydroxamic acid (nngh)
PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d1ycma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ycma2 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

SCOPe Domain Coordinates for d1ycma2:

Click to download the PDB-style file with coordinates for d1ycma2.
(The format of our PDB-style files is described here.)

Timeline for d1ycma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ycma3