SCOPe 2.08: Domain d1ycma2: 1ycm A:106-263

Lineage for d1ycma2 (1ycm A:106-263)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Macrophage elastase (MMP-12) [69780] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69781] (58 PDB entries)
   Uniprot P39900 106-263 ! Uniprot P39900 106-264

8. Domain d1ycma2: 1ycm A:106-263 [122969]
   Other proteins in same PDB: d1ycma3
   automated match to d1os9a_
   complexed with ca, ngh, zn

Details for d1ycma2

PDB Entry: 1ycm

PDB Description: solution structure of matrix metalloproteinase 12 (mmp12) in the presence of n-isobutyl-n-[4-methoxyphenylsulfonyl]glycyl hydroxamic acid (nngh)

PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d1ycma2:

Sequence; same for both SEQRES and ATOM records:

>d1ycma2 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

Timeline for d1ycma2:

• d1ycma2 first appeared in SCOP 1.73, called d1ycma1
  
• d1ycma2 appears in SCOPe 2.07