Lineage for d1ycka1 (1yck A:9-175)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1924236Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 1924237Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. 1924238Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
    Family 2 zinc amidase;
  6. 1924276Protein Peptidoglycan recognition protein, PGRP-S [143786] (1 species)
  7. 1924277Species Human (Homo sapiens) [TaxId:9606] [143787] (1 PDB entry)
    Uniprot O75594 30-196
  8. 1924278Domain d1ycka1: 1yck A:9-175 [122968]

Details for d1ycka1

PDB Entry: 1yck (more details), 1.7 Å

PDB Description: Crystal structure of human peptidoglycan recognition protein (PGRP-S)
PDB Compounds: (A:) Peptidoglycan recognition protein

SCOPe Domain Sequences for d1ycka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ycka1 d.118.1.1 (A:9-175) Peptidoglycan recognition protein, PGRP-S {Human (Homo sapiens) [TaxId: 9606]}
cspivprnewkalasecaqhlslplryvvvshtagsscntpascqqqarnvqhyhmktlg
wcdvgynfligedglvyegrgwnftgahsghlwnpmsigisfmgnymdrvptpqairaaq
gllacgvaqgalrsnyvlkghrdvqrtlspgnqlyhliqnwphyrsp

SCOPe Domain Coordinates for d1ycka1:

Click to download the PDB-style file with coordinates for d1ycka1.
(The format of our PDB-style files is described here.)

Timeline for d1ycka1: