![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) |
![]() | Protein Glutamate receptor ligand binding core [53881] (5 species) |
![]() | Species Norway rat (Rattus norvegicus), GluR5 [TaxId:10116] [142802] (5 PDB entries) Uniprot P22756 429-546,667-799! Uniprot P22756 433-544,682-815 |
![]() | Domain d1ycja1: 1ycj A:430-546,A:667-799 [122966] Other proteins in same PDB: d1ycja2, d1ycjb_ complexed with glu, so4 |
PDB Entry: 1ycj (more details), 1.95 Å
SCOPe Domain Sequences for d1ycja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ycja1 c.94.1.1 (A:430-546,A:667-799) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR5 [TaxId: 10116]} anrtlivttileepyvmyrksdkplygndrfegycldllkelsnilgflydvklvpdgky gaqndkgewngmvkelidhradlavapltityvrekvidfskpfmtlgisilyrkgtXpi dsaddlakqtkieygavrdgstmtffkkskistyekmwafmssrqqsalvknsdegiqrv lttdyallmestsieyvtqrncnltqigglidskgygvgtpigspyrdkitiailqlqee gklhmmkekww
Timeline for d1ycja1: