SCOP 1.73: Domain d1ycja1: 1ycj A:429-546,A:667-799

Lineage for d1ycja1 (1ycj A:429-546,A:667-799)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (35 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (4 species)

7. Species Rat (Rattus norvegicus), GluR5 [TaxId:10116] [142802] (6 PDB entries)

8. Domain d1ycja1: 1ycj A:429-546,A:667-799 [122966]
   complexed with glu, so4

Details for d1ycja1

PDB Entry: 1ycj, 1.95 Å

PDB Description: crystal structure of the kainate receptor glur5 ligand-binding core in complex with (s)-glutamate

PDB Compounds: (A:) Ionotropic glutamate receptor 5

SCOP Domain Sequences for d1ycja1:

Sequence; same for both SEQRES and ATOM records:

>d1ycja1 c.94.1.1 (A:429-546,A:667-799) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR5 [TaxId: 10116]}
ganrtlivttileepyvmyrksdkplygndrfegycldllkelsnilgflydvklvpdgk
ygaqndkgewngmvkelidhradlavapltityvrekvidfskpfmtlgisilyrkgtXp
idsaddlakqtkieygavrdgstmtffkkskistyekmwafmssrqqsalvknsdegiqr
vlttdyallmestsieyvtqrncnltqigglidskgygvgtpigspyrdkitiailqlqe
egklhmmkekww

Timeline for d1ycja1:

• d1ycja1 is new in SCOP 1.73
  
• d1ycja1 appears in SCOP 1.75
  
• d1ycja1 appears in the current release, SCOPe 2.08