Lineage for d1ycia1 (1yci A:14-349)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 677266Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 677672Superfamily b.82.2: Clavaminate synthase-like [51197] (12 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 677786Family b.82.2.6: Hypoxia-inducible factor HIF ihhibitor (FIH1) [82194] (1 protein)
  6. 677787Protein Hypoxia-inducible factor HIF ihhibitor (FIH1) [82195] (1 species)
  7. 677788Species Human (Homo sapiens) [TaxId:9606] [82196] (10 PDB entries)
  8. 677796Domain d1ycia1: 1yci A:14-349 [122965]
    automatically matched to d1mzea_
    complexed with fe2, ndf, so4

Details for d1ycia1

PDB Entry: 1yci (more details), 2.7 Å

PDB Description: Factor inhibiting HIF-1 alpha in complex with N-(carboxycarbonyl)-D-phenylalanine
PDB Compounds: (A:) hypoxia-inducible factor 1 alpha inhibitor

SCOP Domain Sequences for d1ycia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ycia1 b.82.2.6 (A:14-349) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]}
gepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlvypa
lkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhefveklq
diqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnllligmeg
nvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdyerfp
nfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkrieyplkah
qkvaimrniekmlgealgnpqevgpllntmikgryn

SCOP Domain Coordinates for d1ycia1:

Click to download the PDB-style file with coordinates for d1ycia1.
(The format of our PDB-style files is described here.)

Timeline for d1ycia1: