![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (11 families) ![]() |
![]() | Family d.157.1.3: ROO N-terminal domain-like [56291] (3 proteins) |
![]() | Protein Nitric oxide reductase N-terminal domain [143914] (1 species) |
![]() | Species Moorella thermoacetica [TaxId:1525] [143915] (3 PDB entries) |
![]() | Domain d1ychc2: 1ych C:2-250 [122962] Other proteins in same PDB: d1ycha1, d1ychb1, d1ychc1, d1ychd1 automatically matched to 1YCF A:2-250 complexed with feo, fmn, zn |
PDB Entry: 1ych (more details), 2.8 Å
SCOP Domain Sequences for d1ychc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ychc2 d.157.1.3 (C:2-250) Nitric oxide reductase N-terminal domain {Moorella thermoacetica [TaxId: 1525]} sqpvaitdgiywvgavdwniryfhgpafsthrgttynaylivddktalvdtvyepfkeel iaklkqikdpvkldylvvnhtesdhagafpaimelcpdahvlctqrafdslkahyshidf nytivktgtsvslgkrsltfieapmlhwpdsmftyvpeealllpndafgqhiatsvrfdd qvdaglimdeaakyyanilmpfsnlitkkldeiqkinlaiktiapshgiiwrkdpgriie ayarwaegq
Timeline for d1ychc2: