SCOP 1.73: Domain d1ycha1: 1ych A:251-399

Lineage for d1ycha1 (1ych A:251-399)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (8 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (5 proteins)
   binds FMN

6. Protein Nitric oxide reductase C-terminal domain [142047] (1 species)

7. Species Moorella thermoacetica [TaxId:1525] [142048] (3 PDB entries)

8. Domain d1ycha1: 1ych A:251-399 [122957]
   Other proteins in same PDB: d1ycha2, d1ychb2, d1ychc2, d1ychd2
   automatically matched to 1YCF A:251-399
   complexed with feo, fmn, zn

Details for d1ycha1

PDB Entry: 1ych, 2.8 Å

PDB Description: x-ray crystal structures of moorella thermoacetica fpra. novel diiron site structure and mechanistic insights into a scavenging nitric oxide reductase

PDB Compounds: (A:) Nitric oxide reductase

SCOP Domain Sequences for d1ycha1:

Sequence; same for both SEQRES and ATOM records:

>d1ycha1 c.23.5.1 (A:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]}
gkakaviaydtmwlstekmahalmdglvaggcevklfklsvsdrndvikeildaravlvg
sptinndilpvvspllddlvglrpknkvglafgaygwgggaqkileerlkaakieliaep
gptvqwvprgedlqrcyelgrkiaariad

Timeline for d1ycha1:

• d1ycha1 is new in SCOP 1.73
  
• d1ycha1 appears in SCOP 1.75
  
• d1ycha1 appears in the current release, SCOPe 2.08