SCOPe 2.01: Domain d1ycgd1: 1ycg D:251-399

Lineage for d1ycgd1 (1ycg D:251-399)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
   binds FMN

6. Protein Nitric oxide reductase C-terminal domain [142047] (1 species)

7. Species Moorella thermoacetica [TaxId:1525] [142048] (3 PDB entries)
   Uniprot Q9FDN7 251-399

8. Domain d1ycgd1: 1ycg D:251-399 [122955]
   Other proteins in same PDB: d1ycga2, d1ycgb2, d1ycgc2, d1ycgd2
   automatically matched to 1YCF A:251-399
   complexed with edo, feo, fmn, zn

Details for d1ycgd1

PDB Entry: 1ycg, 2.8 Å

PDB Description: x-ray structures of moorella thermoacetica fpra. novel diiron site structure and mechanistic insights into a scavenging nitric oxide reductase

PDB Compounds: (D:) Nitric oxide reductase

SCOPe Domain Sequences for d1ycgd1:

Sequence; same for both SEQRES and ATOM records:

>d1ycgd1 c.23.5.1 (D:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]}
gkakaviaydtmwlstekmahalmdglvaggcevklfklsvsdrndvikeildaravlvg
sptinndilpvvspllddlvglrpknkvglafgaygwgggaqkileerlkaakieliaep
gptvqwvprgedlqrcyelgrkiaariad

Timeline for d1ycgd1:

• d1ycgd1 first appeared in SCOP 1.73
  
• d1ycgd1 appears in SCOP 1.75
  
• d1ycgd1 appears in SCOPe 2.02
  
• d1ycgd1 appears in the current release, SCOPe 2.08