Lineage for d1ycgb2 (1ycg B:2-250)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1440053Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1440054Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1440239Family d.157.1.3: ROO N-terminal domain-like [56291] (4 proteins)
  6. 1440240Protein Nitric oxide reductase N-terminal domain [143914] (2 species)
  7. 1440244Species Moorella thermoacetica [TaxId:1525] [143915] (3 PDB entries)
    Uniprot Q9FDN7 2-250
  8. 1440246Domain d1ycgb2: 1ycg B:2-250 [122952]
    Other proteins in same PDB: d1ycga1, d1ycgb1, d1ycgc1, d1ycgd1
    automated match to d1ycfa2
    complexed with edo, feo, fmn, zn

Details for d1ycgb2

PDB Entry: 1ycg (more details), 2.8 Å

PDB Description: x-ray structures of moorella thermoacetica fpra. novel diiron site structure and mechanistic insights into a scavenging nitric oxide reductase
PDB Compounds: (B:) Nitric oxide reductase

SCOPe Domain Sequences for d1ycgb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ycgb2 d.157.1.3 (B:2-250) Nitric oxide reductase N-terminal domain {Moorella thermoacetica [TaxId: 1525]}
sqpvaitdgiywvgavdwniryfhgpafsthrgttynaylivddktalvdtvyepfkeel
iaklkqikdpvkldylvvnhtesdhagafpaimelcpdahvlctqrafdslkahyshidf
nytivktgtsvslgkrsltfieapmlhwpdsmftyvpeealllpndafgqhiatsvrfdd
qvdaglimdeaakyyanilmpfsnlitkkldeiqkinlaiktiapshgiiwrkdpgriie
ayarwaegq

SCOPe Domain Coordinates for d1ycgb2:

Click to download the PDB-style file with coordinates for d1ycgb2.
(The format of our PDB-style files is described here.)

Timeline for d1ycgb2: