Lineage for d1ycfd1 (1ycf D:251-399)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2115525Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2116045Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2116046Protein automated matches [190158] (24 species)
    not a true protein
  7. Species Moorella thermoacetica [TaxId:1525] [254979] (1 PDB entry)
  8. 2116137Domain d1ycfd1: 1ycf D:251-399 [122947]
    Other proteins in same PDB: d1ycfa1, d1ycfa2, d1ycfb2, d1ycfc2, d1ycfd2
    automated match to d1ycga1
    complexed with feo, fmn, oxy, zn

Details for d1ycfd1

PDB Entry: 1ycf (more details), 3 Å

PDB Description: oxidized (di-ferric) fpra from moorella thermoacetica
PDB Compounds: (D:) Nitric oxide reductase

SCOPe Domain Sequences for d1ycfd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ycfd1 c.23.5.0 (D:251-399) automated matches {Moorella thermoacetica [TaxId: 1525]}
gkakaviaydtmwlstekmahalmdglvaggcevklfklsvsdrndvikeildaravlvg
sptinndilpvvspllddlvglrpknkvglafgaygwgggaqkileerlkaakieliaep
gptvqwvprgedlqrcyelgrkiaariad

SCOPe Domain Coordinates for d1ycfd1:

Click to download the PDB-style file with coordinates for d1ycfd1.
(The format of our PDB-style files is described here.)

Timeline for d1ycfd1: