Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.1: Flavodoxin-related [52219] (6 proteins) binds FMN |
Protein Nitric oxide reductase C-terminal domain [142047] (1 species) |
Species Moorella thermoacetica [TaxId:1525] [142048] (3 PDB entries) Uniprot Q9FDN7 251-399 |
Domain d1ycfd1: 1ycf D:251-399 [122947] Other proteins in same PDB: d1ycfa2, d1ycfb2, d1ycfc2, d1ycfd2 automatically matched to 1YCF A:251-399 complexed with feo, fmn, oxy, zn |
PDB Entry: 1ycf (more details), 3 Å
SCOPe Domain Sequences for d1ycfd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ycfd1 c.23.5.1 (D:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]} gkakaviaydtmwlstekmahalmdglvaggcevklfklsvsdrndvikeildaravlvg sptinndilpvvspllddlvglrpknkvglafgaygwgggaqkileerlkaakieliaep gptvqwvprgedlqrcyelgrkiaariad
Timeline for d1ycfd1: