![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) ![]() |
![]() | Family d.157.1.3: ROO N-terminal domain-like [56291] (3 proteins) |
![]() | Protein Nitric oxide reductase N-terminal domain [143914] (1 species) |
![]() | Species Moorella thermoacetica [TaxId:1525] [143915] (3 PDB entries) Uniprot Q9FDN7 2-250 |
![]() | Domain d1ycfc2: 1ycf C:2-250 [122946] Other proteins in same PDB: d1ycfa1, d1ycfb1, d1ycfc1, d1ycfd1 automatically matched to 1YCF A:2-250 complexed with feo, fmn, oxy, zn |
PDB Entry: 1ycf (more details), 3 Å
SCOPe Domain Sequences for d1ycfc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ycfc2 d.157.1.3 (C:2-250) Nitric oxide reductase N-terminal domain {Moorella thermoacetica [TaxId: 1525]} sqpvaitdgiywvgavdwniryfhgpafsthrgttynaylivddktalvdtvyepfkeel iaklkqikdpvkldylvvnhtesdhagafpaimelcpdahvlctqrafdslkahyshidf nytivktgtsvslgkrsltfieapmlhwpdsmftyvpeealllpndafgqhiatsvrfdd qvdaglimdeaakyyanilmpfsnlitkkldeiqkinlaiktiapshgiiwrkdpgriie ayarwaegq
Timeline for d1ycfc2: