SCOPe 2.06: Domain d1yc6x_: 1yc6 X:

Lineage for d1yc6x_ (1yc6 X:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.5: Bromoviridae-like VP [88639] (2 proteins)

6. Protein Cucumovirus coat protein [88640] (4 species)

7. Species BMV (Brome mosaic virus) [TaxId:12302] [74886] (2 PDB entries)

8. Domain d1yc6x_: 1yc6 X: [122938]

Details for d1yc6x_

PDB Entry: 1yc6, 2.9 Å

PDB Description: Crystallographic Structure of the T=1 Particle of Brome Mosaic Virus

PDB Compounds: (X:) coat protein

SCOPe Domain Sequences for d1yc6x_:

Sequence; same for both SEQRES and ATOM records:

>d1yc6x_ b.121.4.5 (X:) Cucumovirus coat protein {BMV (Brome mosaic virus) [TaxId: 12302]}
aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg
llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy
lyaseavpakavvvhlevehvrptfddfftpvyr

Timeline for d1yc6x_:

• d1yc6x_ first appeared in SCOP 1.73, called d1yc6x1
  
• d1yc6x_ appears in SCOPe 2.05
  
• d1yc6x_ appears in SCOPe 2.07
  
• d1yc6x_ appears in the current release, SCOPe 2.08