Lineage for d1yc6o_ (1yc6 O:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821778Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2822292Family b.121.4.5: Bromoviridae-like VP [88639] (2 proteins)
  6. 2822293Protein Cucumovirus coat protein [88640] (4 species)
  7. 2822294Species BMV (Brome mosaic virus) [TaxId:12302] [74886] (3 PDB entries)
  8. 2822313Domain d1yc6o_: 1yc6 O: [122929]

Details for d1yc6o_

PDB Entry: 1yc6 (more details), 2.9 Å

PDB Description: Crystallographic Structure of the T=1 Particle of Brome Mosaic Virus
PDB Compounds: (O:) coat protein

SCOPe Domain Sequences for d1yc6o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yc6o_ b.121.4.5 (O:) Cucumovirus coat protein {BMV (Brome mosaic virus) [TaxId: 12302]}
aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg
llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy
lyaseavpakavvvhlevehvrptfddfftpvyr

SCOPe Domain Coordinates for d1yc6o_:

Click to download the PDB-style file with coordinates for d1yc6o_.
(The format of our PDB-style files is described here.)

Timeline for d1yc6o_: