Lineage for d1yc6d_ (1yc6 D:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1334432Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1334633Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 1334977Family b.121.4.5: Bromoviridae-like VP [88639] (2 proteins)
  6. 1334978Protein Cucumovirus coat protein [88640] (4 species)
  7. 1334979Species BMV (Brome mosaic virus) [TaxId:12302] [74886] (2 PDB entries)
  8. 1334987Domain d1yc6d_: 1yc6 D: [122918]

Details for d1yc6d_

PDB Entry: 1yc6 (more details), 2.9 Å

PDB Description: Crystallographic Structure of the T=1 Particle of Brome Mosaic Virus
PDB Compounds: (D:) coat protein

SCOPe Domain Sequences for d1yc6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yc6d_ b.121.4.5 (D:) Cucumovirus coat protein {BMV (Brome mosaic virus) [TaxId: 12302]}
aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg
llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy
lyaseavpakavvvhlevehvrptfddfftpvyr

SCOPe Domain Coordinates for d1yc6d_:

Click to download the PDB-style file with coordinates for d1yc6d_.
(The format of our PDB-style files is described here.)

Timeline for d1yc6d_: