Class b: All beta proteins [48724] (165 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (9 families) |
Family b.121.4.5: Bromoviridae-like VP [88639] (1 protein) |
Protein Cucumovirus coat protein [88640] (4 species) |
Species BMV (Brome mosaic virus) [TaxId:12302] [74886] (2 PDB entries) |
Domain d1yc631: 1yc6 3:36-189 [122913] automatically matched to d1js9b_ |
PDB Entry: 1yc6 (more details), 2.9 Å
SCOP Domain Sequences for d1yc631:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yc631 b.121.4.5 (3:36-189) Cucumovirus coat protein {BMV (Brome mosaic virus) [TaxId: 12302]} aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy lyaseavpakavvvhlevehvrptfddfftpvyr
Timeline for d1yc631:
View in 3D Domains from other chains: (mouse over for more information) d1yc611, d1yc621, d1yc641, d1yc6a1, d1yc6b1, d1yc6c1, d1yc6d1, d1yc6e1, d1yc6f1, d1yc6g1, d1yc6h1, d1yc6i1, d1yc6j1, d1yc6k1, d1yc6l1, d1yc6m1, d1yc6n1, d1yc6o1, d1yc6p1, d1yc6q1, d1yc6r1, d1yc6s1, d1yc6t1, d1yc6u1, d1yc6v1, d1yc6w1, d1yc6x1, d1yc6y1, d1yc6z1 |