Lineage for d1yc5a1 (1yc5 A:1-245)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107255Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2107256Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2107522Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (8 protein domains)
    silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain
  6. 2107558Protein NAD-dependent deacetylase NpdA [142126] (1 species)
  7. 2107559Species Thermotoga maritima [TaxId:2336] [142127] (7 PDB entries)
    Uniprot Q9WYW0 1-245
  8. 2107560Domain d1yc5a1: 1yc5 A:1-245 [122910]
    complexed with nca, zn

Details for d1yc5a1

PDB Entry: 1yc5 (more details), 1.4 Å

PDB Description: Sir2-p53 peptide-nicotinamide
PDB Compounds: (A:) NAD-dependent deacetylase

SCOPe Domain Sequences for d1yc5a1:

Sequence, based on SEQRES records: (download)

>d1yc5a1 c.31.1.5 (A:1-245) NAD-dependent deacetylase NpdA {Thermotoga maritima [TaxId: 2336]}
mkmkefldllnesrltvtltgagistpsgipdfrgpngiykkysqnvfdidffyshpeef
yrfakegifpmlqakpnlahvllakleekglieavitqnidrlhqragskkvielhgnve
eyycvrcekkytvedvikklessdvplcddcnslirpnivffgenlpqdalreaiglssr
aslmivlgsslvvypaaelplitvrsggklvivnlgetpfddiatlkynmdvvefarrvm
eeggi

Sequence, based on observed residues (ATOM records): (download)

>d1yc5a1 c.31.1.5 (A:1-245) NAD-dependent deacetylase NpdA {Thermotoga maritima [TaxId: 2336]}
mkmkefldllnesrltvtltgagistpsgipdfqnvfdidffyshpeefyrfakegifpm
lqakpnlahvllakleekglieavitqnidrlhqragskkvielhgnveeyycvrcekky
tvedvikklessdvplcddcnslirpnivffgenlpqdalreaiglssraslmivlgssl
vvypaaelplitvrsggklvivnlgetpfddiatlkynmdvvefarrvmeeggi

SCOPe Domain Coordinates for d1yc5a1:

Click to download the PDB-style file with coordinates for d1yc5a1.
(The format of our PDB-style files is described here.)

Timeline for d1yc5a1: