Lineage for d1ybob1 (1ybo B:110-194)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 666573Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 666574Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 666575Family b.36.1.1: PDZ domain [50157] (46 proteins)
    Pfam PF00595
  6. 666781Protein Syntenin 1 [89311] (1 species)
  7. 666782Species Human (Homo sapiens) [TaxId:9606] [89312] (11 PDB entries)
  8. 666810Domain d1ybob1: 1ybo B:110-194 [122899]
    automatically matched to d1obzb1

Details for d1ybob1

PDB Entry: 1ybo (more details), 2.3 Å

PDB Description: crystal structure of the pdz tandem of human syntenin with syndecan peptide
PDB Compounds: (B:) Syntenin 1

SCOP Domain Sequences for d1ybob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ybob1 b.36.1.1 (B:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]}
mdprevilckdqdgkiglrlksidngifvqlvqanspaslvglrfgdqvlqingencagw
ssdkahkvlkqafgekitmtirdrp

SCOP Domain Coordinates for d1ybob1:

Click to download the PDB-style file with coordinates for d1ybob1.
(The format of our PDB-style files is described here.)

Timeline for d1ybob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ybob2