Lineage for d1yboa1 (1ybo A:111-194)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1785878Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1785879Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1785880Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 1786118Protein Syntenin 1 [89311] (1 species)
  7. 1786119Species Human (Homo sapiens) [TaxId:9606] [89312] (11 PDB entries)
  8. 1786145Domain d1yboa1: 1ybo A:111-194 [122897]
    automatically matched to d1obzb1

Details for d1yboa1

PDB Entry: 1ybo (more details), 2.3 Å

PDB Description: crystal structure of the pdz tandem of human syntenin with syndecan peptide
PDB Compounds: (A:) Syntenin 1

SCOPe Domain Sequences for d1yboa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yboa1 b.36.1.1 (A:111-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]}
dprevilckdqdgkiglrlksidngifvqlvqanspaslvglrfgdqvlqingencagws
sdkahkvlkqafgekitmtirdrp

SCOPe Domain Coordinates for d1yboa1:

Click to download the PDB-style file with coordinates for d1yboa1.
(The format of our PDB-style files is described here.)

Timeline for d1yboa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yboa2