Lineage for d1ybma1 (1ybm A:2-253)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 819736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 820430Protein Hypothetical protein At5g02240 (T7H20_290) [117417] (1 species)
  7. 820431Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117418] (4 PDB entries)
    Uniprot Q94EG6
  8. 820438Domain d1ybma1: 1ybm A:2-253 [122895]
    complexed with nap

Details for d1ybma1

PDB Entry: 1ybm (more details), 2.1 Å

PDB Description: x-ray structure of selenomethionyl gene product from arabidopsis thaliana at5g02240 in space group p21212
PDB Compounds: (A:) unknown protein At5g02240

SCOP Domain Sequences for d1ybma1:

Sequence, based on SEQRES records: (download)

>d1ybma1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
anlptvlvtgasgrtgqivykklkegsdkfvakglvrsaqgkekiggeadvfigditdad
sinpafqgidalviltsavpkmkpgfdptkggrpefifedgqypeqvdwigqknqidaak
vagvkhivvvgsmggtnpdhplnklgngnilvwkrkaeqyladsgtpytiiragglldke
ggvrellvgkddellqtdtktvpradvaevciqallfeeaknkafdlgskpegtstptkd
fkalfsqvtsrf

Sequence, based on observed residues (ATOM records): (download)

>d1ybma1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
anlptvlvtgasgrtgqivykklkegsdkfvakglvrsaqgkekiggeadvfigditdad
sinpafqgidalviltsavpkmkpefifedgqypeqvdwigqknqidaakvagvkhivvv
gsmggtnpdhplnklgngnilvwkrkaeqyladsgtpytiiragglldkeggvrellvgk
ddellqtdtktvpradvaevciqallfeeaknkafdlgskpegtstptkdfkalfsqvts
rf

SCOP Domain Coordinates for d1ybma1:

Click to download the PDB-style file with coordinates for d1ybma1.
(The format of our PDB-style files is described here.)

Timeline for d1ybma1: