Lineage for d1ybja_ (1ybj A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187368Fold d.35: Heme-binding protein A (HasA) [54620] (1 superfamily)
    beta-alpha-beta(6)-alpha(2); antiparallel sheet: order 165432
  4. 2187369Superfamily d.35.1: Heme-binding protein A (HasA) [54621] (2 families) (S)
  5. 2187370Family d.35.1.1: Heme-binding protein A (HasA) [54622] (2 proteins)
    automatically mapped to Pfam PF06438
  6. 2187371Protein Heme-binding protein A (HasA) [54623] (1 species)
  7. 2187372Species Serratia marcescens [TaxId:615] [54624] (6 PDB entries)
  8. 2187381Domain d1ybja_: 1ybj A: [122894]
    automated match to d2uydx_

Details for d1ybja_

PDB Entry: 1ybj (more details)

PDB Description: structural and dynamics studies of both apo and holo forms of the hemophore hasa
PDB Compounds: (A:) hemophore hasa

SCOPe Domain Sequences for d1ybja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ybja_ d.35.1.1 (A:) Heme-binding protein A (HasA) {Serratia marcescens [TaxId: 615]}
afsvnydssfggysihdylgqwastfgdvnhtngnvtdansggfyggslsgsqyaissta
nqvtafvaggnltytlfnepahtlygqldslsfgdglsggdtspysiqvpdvsfgglnls
slqaqghdgvvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaatavgvqh

SCOPe Domain Coordinates for d1ybja_:

Click to download the PDB-style file with coordinates for d1ybja_.
(The format of our PDB-style files is described here.)

Timeline for d1ybja_: