Lineage for d1ybja1 (1ybj A:1-173)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 858472Fold d.35: Heme-binding protein A (HasA) [54620] (1 superfamily)
    beta-alpha-beta(6)-alpha(2); antiparallel sheet: order 165432
  4. 858473Superfamily d.35.1: Heme-binding protein A (HasA) [54621] (1 family) (S)
  5. 858474Family d.35.1.1: Heme-binding protein A (HasA) [54622] (1 protein)
  6. 858475Protein Heme-binding protein A (HasA) [54623] (1 species)
  7. 858476Species Serratia marcescens [TaxId:615] [54624] (5 PDB entries)
  8. 858483Domain d1ybja1: 1ybj A:1-173 [122894]
    automatically matched to d1b2va_

Details for d1ybja1

PDB Entry: 1ybj (more details)

PDB Description: structural and dynamics studies of both apo and holo forms of the hemophore hasa
PDB Compounds: (A:) hemophore hasa

SCOP Domain Sequences for d1ybja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ybja1 d.35.1.1 (A:1-173) Heme-binding protein A (HasA) {Serratia marcescens [TaxId: 615]}
afsvnydssfggysihdylgqwastfgdvnhtngnvtdansggfyggslsgsqyaissta
nqvtafvaggnltytlfnepahtlygqldslsfgdglsggdtspysiqvpdvsfgglnls
slqaqghdgvvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaata

SCOP Domain Coordinates for d1ybja1:

Click to download the PDB-style file with coordinates for d1ybja1.
(The format of our PDB-style files is described here.)

Timeline for d1ybja1: