Lineage for d1ybdc1 (1ybd C:6-241)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 843596Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 843597Superfamily c.73.1: Carbamate kinase-like [53633] (3 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 843640Family c.73.1.3: PyrH-like [142721] (3 proteins)
    part of Pfam PF00696
  6. 843660Protein Uridylate kinase PyrH [142728] (6 species)
  7. 843684Species Neisseria meningitidis [TaxId:487] [142734] (1 PDB entry)
    Uniprot P65932 4-239
  8. 843687Domain d1ybdc1: 1ybd C:6-241 [122886]
    automatically matched to 1YBD A:6-241
    complexed with fmt, gol

Details for d1ybdc1

PDB Entry: 1ybd (more details), 2.6 Å

PDB Description: crystal structure analysis of uridylate kinase from neisseria meningitidis
PDB Compounds: (C:) uridylate kinase

SCOP Domain Sequences for d1ybdc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ybdc1 c.73.1.3 (C:6-241) Uridylate kinase PyrH {Neisseria meningitidis [TaxId: 487]}
qikykrvllklsgeslmgsdpfginhdtivqtvgeiaevvkmgvqvgivvgggnifrgvs
aqagsmdratadymgmmatvmnalalkdafetlgikarvqsalsmqqiaetyarpkaiqy
leegkvvifaagtgnpffttdtaaalrgaemncdvmlkatnvdgvytadpkkdpsatrye
titfdeallknlkvmdatafalcrerklnivvfgiakegslkrvitgedegtlvhc

SCOP Domain Coordinates for d1ybdc1:

Click to download the PDB-style file with coordinates for d1ybdc1.
(The format of our PDB-style files is described here.)

Timeline for d1ybdc1: