SCOP 1.73: Domain d1ybdc1: 1ybd C:6-241

Lineage for d1ybdc1 (1ybd C:6-241)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (3 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.3: PyrH-like [142721] (3 proteins)
   part of Pfam PF00696

6. Protein Uridylate kinase PyrH [142728] (6 species)

7. Species Neisseria meningitidis [TaxId:487] [142734] (1 PDB entry)

8. Domain d1ybdc1: 1ybd C:6-241 [122886]
   automatically matched to 1YBD A:6-241
   complexed with fmt, gol

Details for d1ybdc1

PDB Entry: 1ybd, 2.6 Å

PDB Description: crystal structure analysis of uridylate kinase from neisseria meningitidis

PDB Compounds: (C:) uridylate kinase

SCOP Domain Sequences for d1ybdc1:

Sequence; same for both SEQRES and ATOM records:

>d1ybdc1 c.73.1.3 (C:6-241) Uridylate kinase PyrH {Neisseria meningitidis [TaxId: 487]}
qikykrvllklsgeslmgsdpfginhdtivqtvgeiaevvkmgvqvgivvgggnifrgvs
aqagsmdratadymgmmatvmnalalkdafetlgikarvqsalsmqqiaetyarpkaiqy
leegkvvifaagtgnpffttdtaaalrgaemncdvmlkatnvdgvytadpkkdpsatrye
titfdeallknlkvmdatafalcrerklnivvfgiakegslkrvitgedegtlvhc

Timeline for d1ybdc1:

• d1ybdc1 is new in SCOP 1.73
  
• d1ybdc1 appears in SCOP 1.75
  
• d1ybdc1 appears in the current release, SCOPe 2.08, called d1ybdc_