Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.73: Carbamate kinase-like [53632] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest |
Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase |
Family c.73.1.3: PyrH-like [142721] (4 proteins) part of Pfam PF00696 |
Protein Uridylate kinase PyrH [142728] (6 species) |
Species Neisseria meningitidis [TaxId:487] [142734] (1 PDB entry) Uniprot P65932 4-239 |
Domain d1ybdb_: 1ybd B: [122885] automated match to d1ybda1 complexed with fmt, gol |
PDB Entry: 1ybd (more details), 2.6 Å
SCOPe Domain Sequences for d1ybdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ybdb_ c.73.1.3 (B:) Uridylate kinase PyrH {Neisseria meningitidis [TaxId: 487]} qikykrvllklsgeslmgsdpfginhdtivqtvgeiaevvkmgvqvgivvgggnifrgvs aqagsmdratadymgmmatvmnalalkdafetlgikarvqsalsmqqiaetyarpkaiqy leegkvvifaagtgnpffttdtaaalrgaemncdvmlkatnvdgvytadpkkdpsatrye titfdeallknlkvmdatafalcrerklnivvfgiakegslkrvitgedegtlvhc
Timeline for d1ybdb_: