Lineage for d1ybda1 (1ybd A:6-241)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905127Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 2905128Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 2905205Family c.73.1.3: PyrH-like [142721] (4 proteins)
    part of Pfam PF00696
  6. 2905225Protein Uridylate kinase PyrH [142728] (6 species)
  7. 2905238Species Neisseria meningitidis [TaxId:487] [142734] (1 PDB entry)
    Uniprot P65932 4-239
  8. 2905239Domain d1ybda1: 1ybd A:6-241 [122884]
    complexed with fmt, gol

Details for d1ybda1

PDB Entry: 1ybd (more details), 2.6 Å

PDB Description: crystal structure analysis of uridylate kinase from neisseria meningitidis
PDB Compounds: (A:) uridylate kinase

SCOPe Domain Sequences for d1ybda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ybda1 c.73.1.3 (A:6-241) Uridylate kinase PyrH {Neisseria meningitidis [TaxId: 487]}
qikykrvllklsgeslmgsdpfginhdtivqtvgeiaevvkmgvqvgivvgggnifrgvs
aqagsmdratadymgmmatvmnalalkdafetlgikarvqsalsmqqiaetyarpkaiqy
leegkvvifaagtgnpffttdtaaalrgaemncdvmlkatnvdgvytadpkkdpsatrye
titfdeallknlkvmdatafalcrerklnivvfgiakegslkrvitgedegtlvhc

SCOPe Domain Coordinates for d1ybda1:

Click to download the PDB-style file with coordinates for d1ybda1.
(The format of our PDB-style files is described here.)

Timeline for d1ybda1: