Lineage for d1ybab2 (1yba B:7-107,B:296-326)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2116681Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 2116682Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (7 proteins)
    this domain is interrupted by the Rossmann-fold domain
  6. 2116706Protein Phosphoglycerate dehydrogenase [52293] (2 species)
    has additional C-terminal domain of the ferredoxin fold
  7. 2116707Species Escherichia coli [TaxId:562] [52294] (7 PDB entries)
  8. 2116713Domain d1ybab2: 1yba B:7-107,B:296-326 [122876]
    Other proteins in same PDB: d1ybaa1, d1ybaa3, d1ybab1, d1ybab3, d1ybac1, d1ybac3, d1ybad1, d1ybad3
    automatically matched to d1psda2
    complexed with akg, nad, po4, unl

Details for d1ybab2

PDB Entry: 1yba (more details), 2.24 Å

PDB Description: The active form of phosphoglycerate dehydrogenase
PDB Compounds: (B:) D-3-phosphoglycerate dehydrogenase

SCOPe Domain Sequences for d1ybab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ybab2 c.23.12.1 (B:7-107,B:296-326) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]}
ekdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglrsrthlt
edvinaaeklvaigcfcigtnqvdldaaakrgipvfnapfsXstqeaqeniglevagkli
kysdngstlsavn

SCOPe Domain Coordinates for d1ybab2:

Click to download the PDB-style file with coordinates for d1ybab2.
(The format of our PDB-style files is described here.)

Timeline for d1ybab2: