Lineage for d1ybaa1 (1yba A:108-295)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2105396Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
    this domain interrupts the other domain which defines family
  6. 2105467Protein Phosphoglycerate dehydrogenase [51839] (2 species)
    has additional C-terminal domain of the ferredoxin fold
  7. 2105468Species Escherichia coli [TaxId:562] [51840] (7 PDB entries)
  8. 2105473Domain d1ybaa1: 1yba A:108-295 [122872]
    Other proteins in same PDB: d1ybaa2, d1ybaa3, d1ybab2, d1ybab3, d1ybac2, d1ybac3, d1ybad2, d1ybad3
    automatically matched to d1psda1
    complexed with akg, nad, po4, unl

Details for d1ybaa1

PDB Entry: 1yba (more details), 2.24 Å

PDB Description: The active form of phosphoglycerate dehydrogenase
PDB Compounds: (A:) D-3-phosphoglycerate dehydrogenase

SCOPe Domain Sequences for d1ybaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ybaa1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]}
ntrsvaelvigelllllrgvpeanakahrgvwnklaagsfeargkklgiigyghigtqlg
ilaeslgmyvyfydienklplgnatqvqhlsdllnmsdvvslhvpenpstknmmgakeis
lmkpgsllinasrgtvvdipalcdalaskhlagaaidvfptepatnsdpftsplcefdnv
lltphigg

SCOPe Domain Coordinates for d1ybaa1:

Click to download the PDB-style file with coordinates for d1ybaa1.
(The format of our PDB-style files is described here.)

Timeline for d1ybaa1: