Lineage for d1yb7a_ (1yb7 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901127Family c.69.1.20: Hydroxynitrile lyase-like [53585] (3 proteins)
    automatically mapped to Pfam PF12697
  6. 2901128Protein Hydroxynitrile lyase [53586] (2 species)
  7. 2901160Species Rubber tree (Hevea brasiliensis) [TaxId:3981] [53587] (19 PDB entries)
    Uniprot P52704
  8. 2901172Domain d1yb7a_: 1yb7 A: [122871]
    automated match to d1qj4a_
    complexed with icn, so4

Details for d1yb7a_

PDB Entry: 1yb7 (more details), 1.76 Å

PDB Description: hydroxynitrile lyase from hevea brasiliensis in complex with 2,3- dimethyl-2-hydroxy-butyronitrile
PDB Compounds: (A:) (s)-acetone-cyanohydrin lyase

SCOPe Domain Sequences for d1yb7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yb7a_ c.69.1.20 (A:) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]}
afahfvlihtichgawiwhklkpllealghkvtaldlaasgvdprqieeigsfdeysepl
ltflealppgekvilvgescgglniaiaadkycekiaaavfhnsvlpdtehcpsyvvdkl
mevfpdwkdttyftytkdgkeitglklgftllrenlytlcgpeeyelakmltrkgslfqn
ilakrpfftkegygsikkiyvwtdqdeiflpefqlwqienykpdkvykveggdhklqltk
tkeiaeilqevadtyn

SCOPe Domain Coordinates for d1yb7a_:

Click to download the PDB-style file with coordinates for d1yb7a_.
(The format of our PDB-style files is described here.)

Timeline for d1yb7a_: