Lineage for d1yb3a1 (1yb3 A:2-167)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2615942Fold d.296: YktB/PF0168-like [142912] (1 superfamily)
    alpha-beta(4)-alpha-beta(2)-alpha-beta-alpha; 2 layers, a/b; antiparallel beta-sheet, order: 1234756; half-barrel shape; topological similarity to the MotA C-terminal domain-like fold (69651) and the Secretion chaperone-like fold (69634)
  4. 2615943Superfamily d.296.1: YktB/PF0168-like [142913] (2 families) (S)
  5. 2615948Family d.296.1.2: PF0168-like [142917] (1 protein)
    automatically mapped to Pfam PF11447
  6. 2615949Protein Hypothetical protein PF0168 [142918] (1 species)
  7. 2615950Species Pyrococcus furiosus [TaxId:2261] [142919] (1 PDB entry)
    Uniprot Q8U4C0 2-167
  8. 2615951Domain d1yb3a1: 1yb3 A:2-167 [122869]
    complexed with unx

Details for d1yb3a1

PDB Entry: 1yb3 (more details), 1.6 Å

PDB Description: conserved hypothetical protein pfu-178653-001 from pyrococcus furiosus
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d1yb3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yb3a1 d.296.1.2 (A:2-167) Hypothetical protein PF0168 {Pyrococcus furiosus [TaxId: 2261]}
mlkevhellnriwgdifelreelkeelkgftveevsevfnaylyidgkweemkyphpafa
vkpggevgatpqgfyfvfafpkeelskefiedvirafeklfiygaenfledfynfehpis
gdevwdrivnsdeeminfevdlgfdkeevkreikrfielarrynll

SCOPe Domain Coordinates for d1yb3a1:

Click to download the PDB-style file with coordinates for d1yb3a1.
(The format of our PDB-style files is described here.)

Timeline for d1yb3a1: