Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.296: YktB/PF0168-like [142912] (1 superfamily) alpha-beta(4)-alpha-beta(2)-alpha-beta-alpha; 2 layers, a/b; antiparallel beta-sheet, order: 1234756; half-barrel shape; topological similarity to the MotA C-terminal domain-like fold (69651) and the Secretion chaperone-like fold (69634) |
Superfamily d.296.1: YktB/PF0168-like [142913] (2 families) |
Family d.296.1.2: PF0168-like [142917] (1 protein) automatically mapped to Pfam PF11447 |
Protein Hypothetical protein PF0168 [142918] (1 species) |
Species Pyrococcus furiosus [TaxId:2261] [142919] (1 PDB entry) Uniprot Q8U4C0 2-167 |
Domain d1yb3a1: 1yb3 A:2-167 [122869] complexed with unx |
PDB Entry: 1yb3 (more details), 1.6 Å
SCOPe Domain Sequences for d1yb3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yb3a1 d.296.1.2 (A:2-167) Hypothetical protein PF0168 {Pyrococcus furiosus [TaxId: 2261]} mlkevhellnriwgdifelreelkeelkgftveevsevfnaylyidgkweemkyphpafa vkpggevgatpqgfyfvfafpkeelskefiedvirafeklfiygaenfledfynfehpis gdevwdrivnsdeeminfevdlgfdkeevkreikrfielarrynll
Timeline for d1yb3a1: