Lineage for d1yb0c_ (1yb0 C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579367Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 2579368Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. 2579369Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
    Family 2 zinc amidase;
  6. 2579393Protein N-acetylmuramoyl-L-alanine amidase PlyG [143780] (1 species)
  7. 2579394Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [143781] (2 PDB entries)
    Uniprot Q81WA9 1-157
    Prophage LambdaBa02
  8. 2579397Domain d1yb0c_: 1yb0 C: [122867]
    automated match to d1yb0a1
    complexed with po4, zn

Details for d1yb0c_

PDB Entry: 1yb0 (more details), 1.86 Å

PDB Description: Structure of PlyL
PDB Compounds: (C:) prophage lambdaba02, n-acetylmuramoyl-l-alanine amidase, family 2

SCOPe Domain Sequences for d1yb0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yb0c_ d.118.1.1 (C:) N-acetylmuramoyl-L-alanine amidase PlyG {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
meirkklvvpskygtkcpytmkpkyitvhntyndapaenevnymitnnnevsfhvavddk
qaiqgipwernawacgdgngpgnresisveicysksggdryykaennavdvvrqlmsmyn
ipienvrthqswsgkycphrmlaegrwgafiqkvksg

SCOPe Domain Coordinates for d1yb0c_:

Click to download the PDB-style file with coordinates for d1yb0c_.
(The format of our PDB-style files is described here.)

Timeline for d1yb0c_: