Lineage for d1yb0b1 (1yb0 B:1-157)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 732422Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 732423Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (1 family) (S)
  5. 732424Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (10 proteins)
    Family 2 zinc amidase;
  6. 732432Protein N-acetylmuramoyl-L-alanine amidase PlyG [143780] (1 species)
  7. 732433Species Bacillus anthracis [TaxId:1392] [143781] (2 PDB entries)
    Prophage LambdaBa02
  8. 732435Domain d1yb0b1: 1yb0 B:1-157 [122866]
    automatically matched to 1YB0 A:1-157
    complexed with po4, zn

Details for d1yb0b1

PDB Entry: 1yb0 (more details), 1.86 Å

PDB Description: Structure of PlyL
PDB Compounds: (B:) prophage lambdaba02, n-acetylmuramoyl-l-alanine amidase, family 2

SCOP Domain Sequences for d1yb0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yb0b1 d.118.1.1 (B:1-157) N-acetylmuramoyl-L-alanine amidase PlyG {Bacillus anthracis [TaxId: 1392]}
meirkklvvpskygtkcpytmkpkyitvhntyndapaenevnymitnnnevsfhvavddk
qaiqgipwernawacgdgngpgnresisveicysksggdryykaennavdvvrqlmsmyn
ipienvrthqswsgkycphrmlaegrwgafiqkvksg

SCOP Domain Coordinates for d1yb0b1:

Click to download the PDB-style file with coordinates for d1yb0b1.
(The format of our PDB-style files is described here.)

Timeline for d1yb0b1: