Lineage for d1yb0b_ (1yb0 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972806Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 2972807Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. 2972808Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
    Family 2 zinc amidase;
  6. 2972833Protein N-acetylmuramoyl-L-alanine amidase PlyG [143780] (1 species)
  7. 2972834Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [143781] (2 PDB entries)
    Uniprot Q81WA9 1-157
    Prophage LambdaBa02
  8. 2972836Domain d1yb0b_: 1yb0 B: [122866]
    automated match to d1yb0a1
    complexed with po4, zn

Details for d1yb0b_

PDB Entry: 1yb0 (more details), 1.86 Å

PDB Description: Structure of PlyL
PDB Compounds: (B:) prophage lambdaba02, n-acetylmuramoyl-l-alanine amidase, family 2

SCOPe Domain Sequences for d1yb0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yb0b_ d.118.1.1 (B:) N-acetylmuramoyl-L-alanine amidase PlyG {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
meirkklvvpskygtkcpytmkpkyitvhntyndapaenevnymitnnnevsfhvavddk
qaiqgipwernawacgdgngpgnresisveicysksggdryykaennavdvvrqlmsmyn
ipienvrthqswsgkycphrmlaegrwgafiqkvksgnv

SCOPe Domain Coordinates for d1yb0b_:

Click to download the PDB-style file with coordinates for d1yb0b_.
(The format of our PDB-style files is described here.)

Timeline for d1yb0b_: